PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00027840-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 382aa    MW: 40656.9 Da    PI: 8.8093
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00027840-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.52e-141152344
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                        i n+s r+ +f kRr g+lKK +EL +LC++ + vi++++++
  WALNUT_00027840-RA 11 IVNDSARKASFKKRRGGLLKKVSELTTLCGVSAFVIVYGPDD 52
                        6799***********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.133149IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-18160IPR002100Transcription factor, MADS-box
CDDcd002663.74E-27285No hitNo description
SuperFamilySSF554551.29E-22294IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-6323IPR002100Transcription factor, MADS-box
PfamPF003194.1E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MTRKKVKLMW IVNDSARKAS FKKRRGGLLK KVSELTTLCG VSAFVIVYGP DDQEGAVWPS  60
QQAVQQLLAK FQSVPDIERC KKMMNQETYL RERTTKVQDQ LRKQQRKNKE VEVGHLIRQI  120
QQGRKVEELE MNEMAGLAWM LEEKMKECRK RQECFEQVPH DPGSFASPKS AALVDETSGM  180
GGGTTAAQAK FPTESFMWDQ WFIDMMRQNE NAAGSSSVKT DIGLSPHAYV GGPSGASDVG  240
LPYGNLGGSS GGIEMGLPLG NYSGSSRGSE MGGLPYGSFG INSGASDIGQ PHGSFGGIGG  300
GGVGGDIWLG QPYQYRGNMR GGSTAAASAL GLGMPLGNPG SSSAAGVDAG LNPGALFGGS  360
SAGSNAGLPY DVTKPWPNIF YH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLMWIVNDSARKASFKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110141938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-37AGAMOUS-like 48